Structure of PDB 2zxw Chain S |
>2zxwS (length=93) Species: 9913 (Bos taurus) [Search protein sequence] |
GGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSIT NKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQL |
|
PDB | 2zxw A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump |
Chain | S |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
1.9.3.1: Transferred entry: 7.1.1.9. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S |
C60 C62 C82 C85 |
C57 C59 C79 C82 |
|
|
|
|