Structure of PDB 2ykr Chain S

Receptor sequence
>2ykrS (length=79) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
ChainS
Resolution9.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S R2 S3 L4 K5 K6 G7 P8 F9 H13 K16 K17 R31 W33 R35 R36 H51 N52 G53 R54 Q55 K69 G71 E72 T76 R77 T78 Y79 R80 R1 S2 L3 K4 K5 G6 P7 F8 H12 K15 K16 R30 W32 R34 R35 H50 N51 G52 R53 Q54 K68 G70 E71 T75 R76 T77 Y78 R79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum2ykr
PubMed21788480
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]