Structure of PDB 2xb2 Chain S

Receptor sequence

>2xb2S (length=57) Species: 9606 (Homo sapiens)

HLDDDEDRKNPAYIPRKGLFFEHDLRGRWEHDKFREDEQAPKSRQELIAL
YGYDIRS

3D structure

• PDB: 2xb2 Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.
• Chain: S
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	L187 F188	L19 F20

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding

Biological Process

• GO:0006397 mRNA processing

Cellular Component

• GO:0035145 exon-exon junction complex

External links

• PDB: RCSB:2xb2, PDBe:2xb2, PDBj:2xb2
• PDBsum: 2xb2
• PubMed: 20479275
• UniProt: O15234|CASC3_HUMAN Protein CASC3 (Gene Name=CASC3)