Structure of PDB 2d2c Chain S

Receptor sequence
>2d2cS (length=35) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAEKE
3D structure
PDB2d2c Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
ChainS
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide S G20 W21 G24 L27 E34 G19 W20 G23 L26 E33
BS02 peptide S L26 L27 L25 L26
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2d2c, PDBe:2d2c, PDBj:2d2c
PDBsum2d2c
PubMed16371475
UniProtP83796|PETM_MASLA Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]