Structure of PDB 1s00 Chain S

Receptor sequence

>1s00S (length=299) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYL
GSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYG
LSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLS
AIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPFH
GLSIAFLYGSALLFAMHGATILAVSRFGGECELEQIADRGTAAERAALFW
RWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH

3D structure

PDB

1s00 X-Ray Structure Determination of Three Mutants of the Bacterial Photosynthetic Reaction Centers from Rb. sphaeroides; Altered Proton Transfer Pathways.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	S	Y210 A213 L214 M218 W252	Y208 A211 L212 M216 W250
BS02	FE2	S	H219 E234 H266	H217 E232 H264
BS03	BCL	S	H182 L183	H180 L181
BS04	BCL	S	W66 A153 L156 W157 T186 N187 F189 S190 L196 F197 H202 S205 I206 L209 Y210 T277 G280 I284	W64 A151 L154 W155 T184 N185 F187 S188 L194 F195 H200 S203 I204 L207 Y208 T275 G278 I282
BS05	BCL	S	G203 I206 A207 Y210 L214	G201 I204 A205 Y208 L212
BS06	BPH	S	G63 A125 W129 A149 F150 A153 A273 V274 T277	G61 A123 W127 A147 F148 A151 A271 V272 T275
BS07	U10	S	M218 H219 T222 A249 W252 M256 F258 N259 A260 T261 M262 I265 W268	M216 H217 T220 A247 W250 M254 F256 N257 A258 T259 M260 I263 W266
BS08	SPO	S	F67 F68 I70 G71 W75 S119 M122 F123 W157 G161 F162 W171 V175 Y177 G178 H182	F65 F66 I68 G69 W73 S117 M120 F121 W155 G159 F160 W169 V173 Y175 G176 H180

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1s00, PDBe:1s00, PDBj:1s00
PDBsum	1s00
PubMed	15062092
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]