Structure of PDB 1k73 Chain S

Receptor sequence

>1k73S (length=150) Species: 2238 (Haloarcula marismortui)

GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAV
IEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNAD
HQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP

3D structure

• PDB: 1k73 Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
• Chain: S
• Resolution: 3.01 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	G1 I2 S3 Y4 S5 K15 M17 R19 S24 F25 K26 K29 K60 H62 S64 G65 V66 G67 H68 K69 S70 K71 G74 W75 D76 R79 Y80 E82 K83 N94 N98 H101 H113 A116 H117 V119 Q122 K126 P127 R128 A129 M130 G131 R132 A133 S134 A135 W136 N137 S138	G1 I2 S3 Y4 S5 K15 M17 R19 S24 F25 K26 K29 K60 H62 S64 G65 V66 G67 H68 K69 S70 K71 G74 W75 D76 R79 Y80 E82 K83 N94 N98 H101 H113 A116 H117 V119 Q122 K126 P127 R128 A129 M130 G131 R132 A133 S134 A135 W136 N137 S138

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1k73, PDBe:1k73, PDBj:1k73
• PDBsum: 1k73
• PubMed: 12860128
• UniProt: P10970|RL22_HALMA Large ribosomal subunit protein uL22 (Gene Name=rpl22)