Structure of PDB 1ffk Chain S |
>1ffkS (length=65) Species: 2238 (Haloarcula marismortui) [Search protein sequence] |
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELR KAIARIKTIQGEEGD |
|
PDB | 1ffk The complete atomic structure of the large ribosomal subunit at 2.4 A resolution. |
Chain | S |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
S |
T1 A54 |
T1 A54 |
|
|
|
|