Structure of PDB 1dv3 Chain S

Receptor sequence

>1dv3S (length=299) Species: 1063 (Cereibacter sphaeroides)

YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYL
GSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYG
LSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLS
AIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPFH
GLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFW
RWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH

3D structure

• PDB: 1dv3 Determination of the binding sites of the proton transfer inhibitors Cd2+ and Zn2+ in bacterial reaction centers.
• Chain: S
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	S	G203 I206 A207 Y210 L214	G201 I204 A205 Y208 L212
BS02	BPH	S	Y210 A213 L214 M218 W252	Y208 A211 L212 M216 W250
BS03	FE2	S	H219 E234 H266	H217 E232 H264
BS04	BCL	S	H182 L183	H180 L181
BS05	BCL	S	A153 L156 T186 N187 L196 F197 H202 S205 I206 L209 G280 I284	A151 L154 T184 N185 L194 F195 H200 S203 I204 L207 G278 I282
BS06	BPH	S	S59 G63 W129 A149 F150 A153 A273	S57 G61 W127 A147 F148 A151 A271
BS07	U10	S	M218 H219 T222 A249 W252 M256 F258 N259 A260 T261 I265 W268	M216 H217 T220 A247 W250 M254 F256 N257 A258 T259 I263 W266

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1dv3, PDBe:1dv3, PDBj:1dv3
• PDBsum: 1dv3
• PubMed: 10677497
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)