Structure of PDB 7qvp Chain Rh

Receptor sequence
>7qvpRh (length=41) Species: 9606 (Homo sapiens) [Search protein sequence]
HKRKKVKLAVLKYLRRECPSFMASHFDRHYCGKCCLTYCFN
3D structure
PDB7qvp A distinct mammalian disome collision interface harbors K63-linked polyubiquitination of uS10 to trigger hRQT-mediated subunit dissociation.
ChainRh
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Rh H88 K89 R90 K92 K94 A96 V97 R113 F126 A128 Y135 G137 H1 K2 R3 K5 K7 A9 V10 R15 F21 A23 Y30 G32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qvp, PDBe:7qvp, PDBj:7qvp
PDBsum7qvp
PubMed36302773
UniProtA0A8C0T835

[Back to BioLiP]