Structure of PDB 7qvp Chain RY

Receptor sequence

>7qvpRY (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]

IRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIF
VFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQ
RKERKNRMKKVRG

3D structure

PDB

7qvp A distinct mammalian disome collision interface harbors K63-linked polyubiquitination of uS10 to trigger hRQT-mediated subunit dissociation.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RY	T9 R10 K11 F12 M13 H29 A33 T34 V35 P36 K37 F58 G59 F60 R61 T62 H63 F64 G65 G66 H89 R104 K105 R107 K108 K111 N112 K116 R118	T3 R4 K5 F6 M7 H23 A27 T28 V29 P30 K31 F52 G53 F54 R55 T56 H57 F58 G59 G60 H83 R98 K99 R101 K102 K105 N106 K110 R112

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0031369	translation initiation factor binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0034101	erythrocyte homeostasis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qvp, PDBe:7qvp, PDBj:7qvp
PDBsum	7qvp
PubMed	36302773
UniProt	P62847\|RS24_HUMAN Small ribosomal subunit protein eS24 (Gene Name=RPS24)