Structure of PDB 6ndk Chain RX

Receptor sequence
>6ndkRX (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL
3D structure
PDB6ndk Importance of a tRNA anticodon loop modification and a conserved, noncanonical anticodon stem pairing intRNACGGProfor decoding
ChainRX
Resolution3.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RX M1 K2 S14 K16 K25 T35 K36 T37 N41 E44 K50 K53 N55 T56 L57 H58 R60 K63 K64 Y69 K72 R73 P74 K78 I80 M1 K2 S14 K16 K25 T35 K36 T37 N41 E44 K50 K53 N55 T56 L57 H58 R60 K63 K64 Y69 K72 R73 P74 K78 I80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ndk, PDBe:6ndk, PDBj:6ndk
PDBsum6ndk
PubMed30782843
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]