Structure of PDB 6lqp Chain RV

Receptor sequence

>6lqpRV (length=190) Species: 559292 (Saccharomyces cerevisiae S288C)

PKTQPKVIRFNGPSDVYVPPSKKTQKLLRSENLQNDLELQQFLRESHLLS
AFNGIVYQDDQVIGKARSRTLEMRLNRLSRVNGHQDKINKLEKVPMHIRR
GMIDKHVKRIKKYEQEAAEGGIVLSKVKKGQFRKIESTYKKDIERRIGGS
IKARDKEKATKRERGLKISSVGRSTRNGLIVSKRDIARIS

3D structure

• PDB: 6lqp Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
• Chain: RV
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RV	H224 M236	H84 M96
BS02	rna	RV	A167 E232 K233 P235 I238 G241 K281 R286	A51 E92 K93 P95 I98 G101 K141 R146
BS03	rna	RV	Q150 L231 M236 R239 K266 K269 K292 A293 R294 R302 R304 K307 G312 R313 S314 T315 R316	Q34 L91 M96 R99 K126 K129 K152 A153 R154 R162 R164 K167 G172 R173 S174 T175 R176

Gene Ontology

Molecular Function

• GO:0003674 molecular_function

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:6lqp, PDBe:6lqp, PDBj:6lqp
• PDBsum: 6lqp
• PubMed: 32943522
• UniProt: P40546|FAF1_YEAST Protein FAF1 (Gene Name=FAF1)