Structure of PDB 8pfr Chain RT

Receptor sequence
>8pfrRT (length=91) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.
ChainRT
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RT A2 R4 T5 K6 K7 V8 G9 G12 K13 Y14 G15 V16 R17 Y18 G19 S20 S21 R23 H34 C42 K44 R49 A1 R3 T4 K5 K6 V7 G8 G11 K12 Y13 G14 V15 R16 Y17 G18 S19 S20 R22 H33 C41 K43 R48
BS02 ZN RT C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum8pfr
PubMed
UniProtP0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)

[Back to BioLiP]