Structure of PDB 8fom Chain RS

Receptor sequence

>8fomRS (length=111) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

3D structure

PDB

8fom Structural basis for reduced ribosomal A-site fidelity in response to P-site codon-anticodon mismatches.

Chain

Resolution

3.58 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RS	R3 L4 R9 R10 F12 R13 N16 R17 R20 T21 R23 F87 R89 K93 Y94 F112	R2 L3 R8 R9 F11 R12 N15 R16 R19 T20 R22 F86 R88 K92 Y93 F111
BS02	rna	RS	K11 R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S50 L54 A55 K62 T63 Y92 K93 H95 G96 R97	K10 R14 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 G44 V45 T46 S49 L53 A54 K61 T62 Y91 K92 H94 G95 R96

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8fom, PDBe:8fom, PDBj:8fom
PDBsum	8fom
PubMed	36924943
UniProt	Q5SHQ4\|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)