Structure of PDB 6osi Chain RS

Receptor sequence
>6osiRS (length=111) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF
3D structure
PDB6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainRS
Resolution4.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RS R3 R9 R10 F12 R13 N16 R17 R23 R89 E111 R2 R8 R9 F11 R12 N15 R16 R22 R88 E110
BS02 rna RS R15 R25 F29 R30 S31 L32 K33 Y36 Q38 V46 T47 S50 L54 Y92 K93 H95 R97 R14 R24 F28 R29 S30 L31 K32 Y35 Q37 V45 T46 S49 L53 Y91 K92 H94 R96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum6osi
PubMed33016876
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]