Structure of PDB 6bz8 Chain RS

Receptor sequence
>6bz8RS (length=111) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF
3D structure
PDB6bz8 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
ChainRS
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RS R3 A6 R9 R10 F12 R13 N16 R17 I18 R23 F87 R89 K93 Y94 E111 R2 A5 R8 R9 F11 R12 N15 R16 I17 R22 F86 R88 K92 Y93 E110
BS02 rna RS R10 R15 R30 S31 L32 K33 Y36 G45 V46 T63 Y92 H95 R97 R9 R14 R29 S30 L31 K32 Y35 G44 V45 T62 Y91 H94 R96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz8, PDBe:6bz8, PDBj:6bz8
PDBsum6bz8
PubMed30476222
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]