Structure of PDB 8p60 Chain RR0

Receptor sequence
>8p60RR0 (length=119) Species: 1358809 (Spraguea lophii 42_110) [Search protein sequence]
GQIKGKSVRTASKVIVERYFNRLTNDFYDNRNVVIDVAEIRSKKLRNKVS
GCVTKLYKRVKKNGVPGLYIKEHEEEREKKESFIPKISILDEDKVEVDEV
TMEMINQYEINGDYVLAKK
3D structure
PDB8p60 Spraguea lophii ribosome
ChainRR0
Resolution14.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RR0 G2 Q3 I4 K7 R10 R32 K44 K45 K59 R60 G1 Q2 I3 K6 R9 R31 K43 K44 K58 R59
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 18:21:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8p60', asym_id = 'RR0', title = 'Spraguea lophii ribosome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8p60', asym_id='RR0', title='Spraguea lophii ribosome')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8p60', asym_id = 'RR0'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8p60', asym_id='RR0')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>