Structure of PDB 4tub Chain RR

Receptor sequence

>4tubRR (length=118) Species: 300852 (Thermus thermophilus HB8)

MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDH
LIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKL
AERRRGDGAPLALVELVE

3D structure

• PDB: 4tub Structural insights into translational recoding by frameshift suppressor tRNASufJ.
• Chain: RR
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RR	M1 R2 H3 L4 K5 S6 R8 K9 N11 R12 H13 S14 S15 H16 R17 R22 N23 Q24 K26 S27 H31 I34 T35 T36 T37 K40 K42 R45 G46 D49 H50 H53 R57 L60 H61 R63 R64 L67 R68 Q71 R77 R90 G92 G93 T95 R96 K99 R104 R105 G106 D107	M1 R2 H3 L4 K5 S6 R8 K9 N11 R12 H13 S14 S15 H16 R17 R22 N23 Q24 K26 S27 H31 I34 T35 T36 T37 K40 K42 R45 G46 D49 H50 H53 R57 L60 H61 R63 R64 L67 R68 Q71 R77 R90 G92 G93 T95 R96 K99 R104 R105 G106 D107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4tub, PDBe:4tub, PDBj:4tub
• PDBsum: 4tub
• PubMed: 25352689
• UniProt: Q9Z9H5|RL17_THET8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)