Structure of PDB 6oxi Chain RQ

Receptor sequence

>6oxiRQ (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 6oxi Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
• Chain: RQ
• Resolution: 3.495 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RQ	R6 R10	R6 R10
BS02	rna	RQ	P4 R5 R6 K8 Y9 K11 Q13 R14 G15 R16 K18 T21 K22 G23 Y26 F29 A40 W41 Q46 A49 R56 R59 K63 R67 F69 D71 K77 E80 R82 M83 G84 K85 G86 K87 R101 R119 I120 H123 K124 P126 K128	P4 R5 R6 K8 Y9 K11 Q13 R14 G15 R16 K18 T21 K22 G23 Y26 F29 A40 W41 Q46 A49 R56 R59 K63 R67 F69 D71 K77 E80 R82 M83 G84 K85 G86 K87 R101 R119 I120 H123 K124 P126 K128
BS03	rna	RQ	R16 L17 K18	R16 L17 K18
BS04	MG	RQ	G122 L125 I127	G122 L125 I127
BS05	MG	RQ	T21 P99 G100 R101	T21 P99 G100 R101

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6oxi, PDBe:6oxi, PDBj:6oxi
• PDBsum: 6oxi
• PubMed: 31501867
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)