Structure of PDB 6osi Chain RQ

Receptor sequence

>6osiRQ (length=141) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

PDB

6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.

Chain

Resolution

4.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RQ	K8 Y9 K11 Q12 Q13 R14 G15 T21 K22 G23 G24 Y26 F29 Q46 A49 R56 R60 K63 R67 F69 D71 Y74 K76 L79 V81 R82 G84 K85 R119 I120 H123 K124 P126 K128 K130 A140	K8 Y9 K11 Q12 Q13 R14 G15 T21 K22 G23 G24 Y26 F29 Q46 A49 R56 R60 K63 R67 F69 D71 Y74 K76 L79 V81 R82 G84 K85 R119 I120 H123 K124 P126 K128 K130 A140
BS02	rna	RQ	R16 L17 K18 T21	R16 L17 K18 T21

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum	6osi
PubMed	33016876
UniProt	P60489\|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)