Structure of PDB 6nta Chain RQ

Receptor sequence

>6ntaRQ (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 6nta Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: RQ
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RQ	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 T21 K22 G23 G24 Y26 F29 W41 Q46 A49 R56 R59 K63 R67 F69 D71 Y74 K76 K77 L79 V81 R82 G84 K85 G86 R101 R119 H123 K124 P126 K128 A140 Q141	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 T21 K22 G23 G24 Y26 F29 W41 Q46 A49 R56 R59 K63 R67 F69 D71 Y74 K76 K77 L79 V81 R82 G84 K85 G86 R101 R119 H123 K124 P126 K128 A140 Q141
BS02	rna	RQ	R16 L17 K18	R16 L17 K18
BS03	MG	RQ	T21 K22 G23	T21 K22 G23

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nta, PDBe:6nta, PDBj:6nta
• PDBsum: 6nta
• PubMed: 33016876
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)