Structure of PDB 6lqq Chain RQ

Receptor sequence
>6lqqRQ (length=226) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IDDRQVIENANLLKGKSSTYEVPLPQRIQQRHDRKAAYEISRQEVSKWND
IVQQNRRADHLIFPLNKPTEHNHASAFTRTQDVPQTELQEKVDQVLQESN
LANPEKDSKFEELPEEMRKRTTEMRLMRELMFREERKARRLKKIKSKTYR
KILQNVIINEKVNKKNLKYQSSAVPFPFENREQYERSLRMPIGQEWTSRA
SHQELIKPRIMTKPGQVIDPLKAPFK
3D structure
PDB6lqq Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
ChainRQ
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna RQ E320 H321 N322 H323 S325 D332 M373 E833 K834 V835 K838 R872 Q876 K880 M884 K886 E70 H71 N72 H73 S75 D82 M117 E160 K161 V162 K165 R199 Q203 K207 M211 K213
BS02 rna RQ Q303 R306 R307 F849 Q53 R56 R57 F176
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
GO:0005524 ATP binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6lqq, PDBe:6lqq, PDBj:6lqq
PDBsum6lqq
PubMed32943522
UniProtQ04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 (Gene Name=UTP14)

[Back to BioLiP]