Structure of PDB 6ke6 Chain RQ

Receptor sequence

>6ke6RQ (length=226) Species: 559292 (Saccharomyces cerevisiae S288C)

IDDRQVIENANLLKGKSSTYEVPLPQRIQQRHDRKAAYEISRQEVSKWND
IVQQNRRADHLIFPLNKPTEHNHASAFTRTQDVPQTELQEKVDQVLQESN
LANPEKDSKFEELPEEMRKRTTEMRLMRELMFREERKARRLKKIKSKTYR
KILQNVIINEKVNKKNLKYQSSAVPFPFENREQYERSLRMPIGQEWTSRA
SHQELIKPRIMTKPGQVIDPLKAPFK

3D structure

• PDB: 6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
• Chain: RQ
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RQ	E320 H321 N322 H323 T328 D332 M373 K834 V835 Q876 K880 M884 K886	E70 H71 N72 H73 T78 D82 M117 K161 V162 Q203 K207 M211 K213
BS02	rna	RQ	Q303 R306 R307 F849	Q53 R56 R57 F176

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding
• GO:0005524 ATP binding

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
• PDBsum: 6ke6
• UniProt: Q04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 (Gene Name=UTP14)