Structure of PDB 5vpp Chain RQ

Receptor sequence

>5vppRQ (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 5vpp Mechanism of tRNA-mediated +1 ribosomal frameshifting.
• Chain: RQ
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RQ	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 T21 K22 G23 Y26 Q46 A49 R56 R59 K63 R67 F69 Y74 K76 L79 V81 R82 M83 G84 K85 G86 R101 H123 K124 P126 K128 Q141	R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 L17 T21 K22 G23 Y26 Q46 A49 R56 R59 K63 R67 F69 Y74 K76 L79 V81 R82 M83 G84 K85 G86 R101 H123 K124 P126 K128 Q141
BS02	rna	RQ	R16 L17	R16 L17
BS03	MG	RQ	P78 L79	P78 L79
BS04	MG	RQ	G122 H123 K124 L125	G122 H123 K124 L125

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5vpp, PDBe:5vpp, PDBj:5vpp
• PDBsum: 5vpp
• PubMed: 30262649
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)