Structure of PDB 6oj2 Chain RP

Receptor sequence

>6oj2RP (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

PDB

6oj2 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	RP	K2 S4 R7 P8 N9 G11 A12 N13 K14 R15 R16 K17 R18 R21 P23 H27 G28 K29 T30 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 R50 F51 E52 G53 G54 R55 S56 L59 M60 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 N84 K107 K108 K113 L115 G116 S131 K132 S133	K2 S4 R7 P8 N9 G11 A12 N13 K14 R15 R16 K17 R18 R21 P23 H27 G28 K29 T30 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 R50 F51 E52 G53 G54 R55 S56 L59 M60 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 N84 K107 K108 K113 L115 G116 S131 K132 S133
BS02	MG	RP	T30 G34 H35	T30 G34 H35
BS03	MG	RP	E52 T58	E52 T58

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6oj2, PDBe:6oj2, PDBj:6oj2
PDBsum	6oj2
PubMed	32601241
UniProt	Q5SHQ7\|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)

[Back to BioLiP]