Structure of PDB 6bz6 Chain RP

Receptor sequence

>6bz6RP (length=150) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 6bz6 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Chain: RP
• Resolution: 3.18 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RP	S4 R7 N9 G11 A12 N13 K14 R15 R16 K17 R18 R21 P23 G28 K29 T30 A31 T32 R33 G34 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 R50 F51 E52 G53 G54 R55 S56 L59 M60 L62 P63 K64 G66 M67 Q68 Q70 V71 P72 G73 E74 Q81 N84 K107 K113 L115 G116 S131 K132	S4 R7 N9 G11 A12 N13 K14 R15 R16 K17 R18 R21 P23 G28 K29 T30 A31 T32 R33 G34 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 R50 F51 E52 G53 G54 R55 S56 L59 M60 L62 P63 K64 G66 M67 Q68 Q70 V71 P72 G73 E74 Q81 N84 K107 K113 L115 G116 S131 K132
BS02	MG	RP	E52 T58	E52 T58

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bz6, PDBe:6bz6, PDBj:6bz6
• PDBsum: 6bz6
• PubMed: 30476222
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)