Structure of PDB 8pfr Chain RN

Receptor sequence
>8pfrRN (length=50) Species: 10090 (Mus musculus) [Search protein sequence]
ASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL
3D structure
PDB8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.
ChainRN
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RN A2 S3 H4 K5 K10 L13 Q17 I35 Y37 S39 R41 R42 H43 W44 R45 K48 L49 A1 S2 H3 K4 K9 L12 Q16 I34 Y36 S38 R40 R41 H42 W43 R44 K47 L48
BS02 rna RN F7 R8 R11 K15 K18 Q19 R21 I23 P24 W26 M29 K30 T31 I35 K40 F6 R7 R10 K14 K17 Q18 R20 I22 P23 W25 M28 K29 T30 I34 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0007283 spermatogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum8pfr
PubMed
UniProtQ9CQD0|RL39L_MOUSE Large ribosomal subunit protein eL39-like (Gene Name=Rpl39l)

[Back to BioLiP]