Structure of PDB 1vvj Chain RN

Receptor sequence
>1vvjRN (length=138) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL
3D structure
PDB1vvj Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainRN
Resolution3.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RN T3 G24 R25 T28 R35 K37 N45 F51 T63 K65 K66 Q69 R74 Y75 S76 Y78 G80 K83 R97 E100 H101 A102 G105 M106 P108 G110 P111 K118 T3 G24 R25 T28 R35 K37 N45 F51 T63 K65 K66 Q69 R74 Y75 S76 Y78 G80 K83 R97 E100 H101 A102 G105 M106 P108 G110 P111 K118
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vvj, PDBe:1vvj, PDBj:1vvj
PDBsum1vvj
PubMed25128388
UniProtP60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)

[Back to BioLiP]