Structure of PDB 8p8n Chain RI

Receptor sequence
>8p8nRI (length=96) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAAS
3D structure
PDB8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.
ChainRI
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RI G14 K15 K25 I26 S27 Y28 K30 G31 A33 S34 N35 R41 Y53 R68 R76 F80 R82 K84 G13 K14 K24 I25 S26 Y27 K29 G30 A32 S33 N34 R40 Y52 R67 R75 F79 R81 K83
BS02 MG RI K25 S27 K24 S26
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum8p8n
PubMed
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]