Structure of PDB 8pfr Chain RG

Receptor sequence

>8pfrRG (length=100) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RG	A2 R4 V5 T6 F7 R8 R9 R10 N11 P12 Y13 N14 T15 R16 K24 T25 P26 G27 R31 Q33 K36 K37 L38 T40 R41 P42 K43 Q52 G53 I54 S55 T56 P59 R60 S66 K67 T68 K70 V72 S73 R74 Y76 G78 S79 R80 R88 R91 A92 I95 E96 Q98 K99	A1 R3 V4 T5 F6 R7 R8 R9 N10 P11 Y12 N13 T14 R15 K23 T24 P25 G26 R30 Q32 K35 K36 L37 T39 R40 P41 K42 Q51 G52 I53 S54 T55 P58 R59 S65 K66 T67 K69 V71 S72 R73 Y75 G77 S78 R79 R87 R90 A91 I94 E95 Q97 K98
BS02	ZN	RG	C44 C47 C84	C43 C46 C83

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P87262\|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)