Structure of PDB 8fom Chain RG

Receptor sequence

>8fomRG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 8fom Structural basis for reduced ribosomal A-site fidelity in response to P-site codon-anticodon mismatches.
• Chain: RG
• Resolution: 3.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RG	S76 S78	S75 S77
BS02	rna	RG	N40 G42 L43 G44 T71 K74 K75 I77 F80 L82 I88 R91 S124 F125 D126 R128 N130 N132 R136 G154 M155 D156	N39 G41 L42 G43 T70 K73 K74 I76 F79 L81 I87 R90 S123 F124 D125 R127 N129 N131 R135 G153 M154 D155
BS03	rna	RG	N27 W29 Q66 K67 A69 V70 R91 V92 T93 R95 R96	N26 W28 Q65 K66 A68 V69 R90 V91 T92 R94 R95

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fom, PDBe:8fom, PDBj:8fom
• PDBsum: 8fom
• PubMed: 36924943
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)