Structure of PDB 6oxa Chain RG

Receptor sequence

>6oxaRG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

6oxa Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	RG	S76 I77 S78	S75 I76 S77
BS02	rna	RG	K36 V38 N40 G42 G44 E45 T71 A73 K74 N79 F80 L82 I88 R91 S124 F125 D126 N130 N132 G134 L135 G154 D156	K35 V37 N39 G41 G43 E44 T70 A72 K73 N78 F79 L81 I87 R90 S123 F124 D125 N129 N131 G133 L134 G153 D155
BS03	rna	RG	P2 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96	P1 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6oxa, PDBe:6oxa, PDBj:6oxa
PDBsum	6oxa
PubMed	31501867
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]