Structure of PDB 5vpo Chain RG

Receptor sequence

>5vpoRG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

5vpo Mechanism of tRNA-mediated +1 ribosomal frameshifting.

Chain

Resolution

3.34 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RG	K36 N40 G42 G44 E45 T71 K74 N79 F80 L82 I88 R91 S124 D126 R128 N130 N132 G134 L135 G154 M155 D156 A158	K35 N39 G41 G43 E44 T70 K73 N78 F79 L81 I87 R90 S123 D125 R127 N129 N131 G133 L134 G153 M154 D155 A157
BS02	rna	RG	P2 N27 V28 W29 E30 R33 Q66 K67 A69 V70 R91 V92 T93 R95 R96	P1 N26 V27 W28 E29 R32 Q65 K66 A68 V69 R90 V91 T92 R94 R95

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5vpo, PDBe:5vpo, PDBj:5vpo
PDBsum	5vpo
PubMed	30262649
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]