Structure of PDB 4lfz Chain RG

Receptor sequence
>4lfzRG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB4lfz Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainRG
Resolution3.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RG N40 G42 G44 E45 K47 K74 N79 F80 L82 R91 R128 R153 G154 N39 G41 G43 E44 K46 K73 N78 F79 L81 R90 R127 R152 G153
BS02 rna RG P2 N27 V28 W29 E30 Q66 K67 P68 A69 V70 R72 R91 V92 T93 R95 R96 R98 P1 N26 V27 W28 E29 Q65 K66 P67 A68 V69 R71 R90 V91 T92 R94 R95 R97
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lfz, PDBe:4lfz, PDBj:4lfz
PDBsum4lfz
PubMed25128388
UniProtQ5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]