Structure of PDB 8rd8 Chain RF

Receptor sequence

>8rd8RF (length=109) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

MEVTAKLRGAAISAQKVRLVADEVRGKSIERALDILTYSNKKGAVFVKKC
LNSAIANAEHNHGLDIDGLKVATIYVDEGITLKRILPRAKGRADRISKRT
CHITIKVGE

3D structure

PDB

8rd8 A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RF	T4 K6 L7 R8 S13 Q15 K16 R18 R25 N40 K41 K42 K49 S53 A56 N57 H60 N61 Y75 D77 E78 I80 K83 R84 P87 R88 A89 K90 G91 R92 A93 D94 I96 S97 K98 R99 H102	T4 K6 L7 R8 S13 Q15 K16 R18 R25 N40 K41 K42 K49 S53 A56 N57 H60 N61 Y75 D77 E78 I80 K83 R84 P87 R88 A89 K90 G91 R92 A93 D94 I96 S97 K98 R99 H102

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links