Structure of PDB 6osi Chain RF

Receptor sequence

>6osiRF (length=202) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

PDB

6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.

Chain

Resolution

4.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	RF	H31 R38 K43 R44 R45 R46 T48 S50 K52 T53 R54 Y59 S60 R62 K63 Q67 K68 H69 R72 R74 H75 G76 I82 V84 G85 V89 F90 P92 R95 Y99 T100 P102 K103 K104 R106 K108 T136 R165 R168 N169 P171 T175 N182 Y184	H26 R33 K38 R39 R40 R41 T43 S45 K47 T48 R49 Y54 S55 R57 K58 Q62 K63 H64 R67 R69 H70 G71 I77 V79 G80 V84 F85 P87 R90 Y94 T95 P97 K98 K99 R101 K103 T131 R160 R163 N164 P166 T170 N177 Y179
BS02	MG	RF	G55 V57	G50 V52
BS03	MG	RF	L170 V173	L165 V168

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum	6osi
PubMed	33016876
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]