Structure of PDB 6o3m Chain RF

Receptor sequence

>6o3mRF (length=202) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

PDB

6o3m Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.

Chain

Resolution

3.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RF	N29 H31 W34 E35 R38 Q40 L41 K43 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 R62 Q67 K68 H69 G71 R72 A73 R74 H75 G76 I82 F83 V84 G85 V89 F90 P92 R95 Y99 T100 P102 K103 K104 R106 K135 T136 R165 R168 N169 P171 G180 N182 Y184 R205	N24 H26 W29 E30 R33 Q35 L36 K38 R39 R40 R41 T43 A44 S45 T46 K47 T48 R49 G50 V52 A53 Y54 S55 R57 Q62 K63 H64 G66 R67 A68 R69 H70 G71 I77 F78 V79 G80 V84 F85 P87 R90 Y94 T95 P97 K98 K99 R101 K130 T131 R160 R163 N164 P166 G175 N177 Y179 R200
BS02	MG	RF	R168 L170	R163 L165

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6o3m, PDBe:6o3m, PDBj:6o3m
PDBsum	6o3m
PubMed	33016876
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]