Structure of PDB 8pfr Chain RD

Receptor sequence

>8pfrRD (length=97) Species: 4932 (Saccharomyces cerevisiae)

DVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPEL
NQAIWKRGVKGVEYRLRLRISRKRPLFSYVEPVLVASAKGLQTVVVE

3D structure

• PDB: 8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.
• Chain: RD
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RD	R10 T13 N15 H17 K18 R19 H21 G22 V23 S24 F25 K26 K27 R28 K34 F39 H43 L51 P53 N56 Q57 W60 R62 V64 K65 Y69 R70 K102 L104 Q105 T106	R5 T8 N10 H12 K13 R14 H16 G17 V18 S19 F20 K21 K22 R23 K29 F34 H38 L46 P48 N51 Q52 W55 R57 V59 K60 Y64 R65 K89 L91 Q92 T93

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006450 regulation of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
• PDBsum: 8pfr
• UniProt: P0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)