Structure of PDB 8p8n Chain RD

Receptor sequence

>8p8nRD (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

DVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPEL
NQAIWKRGVKGVEYRLRLRISRKRPLFSYVEPVLVASAKGLQTVVVE

3D structure

PDB

8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RD	R10 T13 N15 H17 K18 R19 H21 G22 V23 S24 F25 K26 K27 R28 V33 K34 F39 H43 L51 P53 N56 Q57 W60 R62 G63 V64 K65 Y69 R70 L104 Q105 T106	R5 T8 N10 H12 K13 R14 H16 G17 V18 S19 F20 K21 K22 R23 V28 K29 F34 H38 L46 P48 N51 Q52 W55 R57 G58 V59 K60 Y64 R65 L91 Q92 T93

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006450	regulation of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum	8p8n
PubMed
UniProt	P0C2H8\|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)