Structure of PDB 8p8n Chain RB

Receptor sequence
>8p8nRB (length=55) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAA
3D structure
PDB8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.
ChainRB
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RB A2 K3 K5 N6 H7 T8 A9 H10 N11 Q12 T13 R14 K15 H17 K23 K25 T26 Y27 K28 Y29 K33 D36 P37 F39 R41 N42 H43 K44 H45 A46 L47 G49 A1 K2 K4 N5 H6 T7 A8 H9 N10 Q11 T12 R13 K14 H16 K22 K24 T25 Y26 K27 Y28 K32 D35 P36 F38 R40 N41 H42 K43 H44 A45 L46 G48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum8p8n
PubMed
UniProtP05747|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)

[Back to BioLiP]