Structure of PDB 6b4v Chain RB

Receptor sequence

>6b4vRB (length=141) Species: 262724 (Thermus thermophilus HB27)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDFGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
• Chain: RB
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RB	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 K18 K22 G24 Y26 F29 A40 W41 Q46 R56 R59 R67 F69 D71 Y74 K76 K77 R82 M83 G84 K85 K87 G88 R101 R119 H123 K124 P126 K128	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 K18 K22 G24 Y26 F29 A40 W41 Q46 R56 R59 R67 F69 D71 Y74 K76 K77 R82 M83 G84 K85 K87 G88 R101 R119 H123 K124 P126 K128
BS02	rna	RB	R16 G19	R16 G19

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
• PDBsum: 6b4v
• PubMed: 29366636
• UniProt: Q72I11|RL16_THET2 Large ribosomal subunit protein uL16 (Gene Name=rplP)