Structure of PDB 5d8b Chain RB

Receptor sequence
>5d8bRB (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL
3D structure
PDB5d8b Ribosome Structure Reveals Preservation of Active Sites in the Presence of a P-Site Wobble Mismatch.
ChainRB
Resolution3.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna RB S8 A15 I18 Q19 R20 R21 K23 K25 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 S65 H66 K69 R76 G79 R81 K92 S1 A8 I11 Q12 R13 R14 K16 K18 K26 T27 T28 K32 R33 R34 Q35 Y36 P37 N38 Q40 K41 S58 H59 K62 R69 G72 R74 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5d8b, PDBe:5d8b, PDBj:5d8b
PDBsum5d8b
PubMed26412335
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]