Structure of PDB 8p8u Chain RA

Receptor sequence

>8p8uRA (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPG
YFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPV
IDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA

3D structure

PDB

8p8u Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.23 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	RA	P2 S3 R4 T6 K7 T8 R9 K10 R12 G13 V15 G18 K19 G20 R21 I22 G23 H25 R26 K27 H28 P29 G30 G31 R32 G33 M34 G36 H39 H40 H41 R42 I43 N44 Y52 F53 G54 K55 V56 M58 R59 Y60 F61 H62 K63 H67 V72 N74 K111 L113 G114 K115 R117 S131 K132 L133	P1 S2 R3 T5 K6 T7 R8 K9 R11 G12 V14 G17 K18 G19 R20 I21 G22 H24 R25 K26 H27 P28 G29 G30 R31 G32 M33 G35 H38 H39 H40 R41 I42 N43 Y51 F52 G53 K54 V55 M57 R58 Y59 F60 H61 K62 H66 V71 N73 K110 L112 G113 K114 R116 S130 K131 L132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p8u, PDBe:8p8u, PDBj:8p8u
PDBsum	8p8u
PubMed
UniProt	P02406\|RL28_YEAST Large ribosomal subunit protein uL15 (Gene Name=RPL28)

[Back to BioLiP]