Structure of PDB 4p6f Chain R9

Receptor sequence
>4p6fR9 (length=37) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB4p6f Macrolide-Peptide Conjugates as Probes of the Path of Travel of the Nascent Peptides through the Ribosome.
ChainR9
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna R9 M1 R4 A5 S6 V7 K8 K15 I17 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 G37 M1 R4 A5 S6 V7 K8 K15 I17 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 G37
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4p6f, PDBe:4p6f, PDBj:4p6f
PDBsum4p6f
PubMed25198768
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]