Structure of PDB 5vpp Chain R8

Receptor sequence

>5vppR8 (length=64) Species: 300852 (Thermus thermophilus HB8)

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE

3D structure

• PDB: 5vpp Mechanism of tRNA-mediated +1 ribosomal frameshifting.
• Chain: R8
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R8	P2 K3 M4 K5 T6 H7 K8 K12 R13 T17 A18 S19 K21 K26 T27 G28 K29 R30 H31 L32 N33 W34 K39 I41 R42 R46 K47 K52 L61 Y64 E65	P1 K2 M3 K4 T5 H6 K7 K11 R12 T16 A17 S18 K20 K25 T26 G27 K28 R29 H30 L31 N32 W33 K38 I40 R41 R45 K46 K51 L60 Y63 E64
BS02	MG	R8	F48 V49 L50	F47 V48 L49
BS03	MG	R8	A51 K52	A50 K51

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5vpp, PDBe:5vpp, PDBj:5vpp
• PDBsum: 5vpp
• PubMed: 30262649
• UniProt: Q5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)