Structure of PDB 4ypb Chain R6

Receptor sequence
>4ypbR6 (length=48) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVK
3D structure
PDB4ypb Defining the mRNA recognition signature of a bacterial toxin protein.
ChainR6
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna R6 R6 K8 R18 Y21 K25 K27 R28 E35 R37 K38 Y39 H46 R1 K3 R13 Y16 K20 K22 R23 E30 R32 K33 Y34 H41
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ypb, PDBe:4ypb, PDBj:4ypb
PDBsum4ypb
PubMed26508639
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]