Structure of PDB 4lsk Chain R6

Receptor sequence
>4lskR6 (length=49) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVK
3D structure
PDB4lsk Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainR6
Resolution3.48001 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R6 V5 R6 K8 T23 E24 K25 K27 R28 P31 R37 K38 Y39 C40 K45 H46 V1 R2 K4 T19 E20 K21 K23 R24 P27 R33 K34 Y35 C36 K41 H42
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lsk, PDBe:4lsk, PDBj:4lsk
PDBsum4lsk
PubMed25128388
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]