Structure of PDB 5m1j Chain R5

Receptor sequence

>5m1jR5 (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
• Chain: R5
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R5	R162 R163 K165 N166 R170 R172 R176	R161 R162 K164 N165 R169 R171 R175
BS02	rna	R5	L4 R5 T6 K8 L10 G18 K19 R20 K21 L24 S37 R38 R42 K43 K53 V55 V57 H58 S59 K60 S61 R62 R64 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 R85 E86 A87 R88 Q92 W95 I96 R97 L99 R100 R103 R104 R110 K114 K117 H118 Y120 H121 Y124 K125 K128 G129 N130 I143	L3 R4 T5 K7 L9 G17 K18 R19 K20 L23 S36 R37 R41 K42 K52 V54 V56 H57 S58 K59 S60 R61 R63 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 R84 E85 A86 R87 Q91 W94 I95 R96 L98 R99 R102 R103 R109 K113 K116 H117 Y119 H120 Y123 K124 K127 G128 N129 I142
BS03	MG	R5	H66 K70	H65 K69

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
• PDBsum: 5m1j
• PubMed: 27995908
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)