Structure of PDB 4tud Chain R5

Receptor sequence
>4tudR5 (length=59) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGY
YAGRKVLEV
3D structure
PDB4tud Structural insights into translational recoding by frameshift suppressor tRNASufJ.
ChainR5
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna R5 A2 K3 H4 V6 P7 K8 K9 K10 T11 S12 K13 A14 R15 R16 A18 R19 R20 S21 H22 H23 T29 H43 A1 K2 H3 V5 P6 K7 K8 K9 T10 S11 K12 A13 R14 R15 A17 R18 R19 S20 H21 H22 T28 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4tud, PDBe:4tud, PDBj:4tud
PDBsum4tud
PubMed25352689
UniProtP80339|RL32_THET8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]