Structure of PDB 6o3m Chain R4 |
>6o3mR4 (length=69) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRYGDSYRK |
|
PDB | 6o3m Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing. |
Chain | R4 |
Resolution | 3.97 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
R4 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|